Anti-Glutathione Peroxidase 2 / GPX2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88736-100
Article Name: Anti-Glutathione Peroxidase 2 / GPX2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88736-100
Supplier Catalog Number: A88736-100
Alternative Catalog Number: ABC-A88736-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human GPX2 (NP_002074.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Glutathione Peroxidase 2 / GPX2.
Clonality: Polyclonal
Molecular Weight: 21 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: TLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
Target: Glutathione Peroxidase 2 / GPX2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200