Anti-ARL8B Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88749-50
Article Name: Anti-ARL8B Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88749-50
Supplier Catalog Number: A88749-50
Alternative Catalog Number: ABC-A88749-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 127-186 of human ARL8B (NP_060654.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ARL8B.
Clonality: Polyclonal
Molecular Weight: 21 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: VLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Target: ARL8B
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:3,000, ICC/IF: 1:50-1:200