Anti-Claudin 4 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88764-100
Article Name: Anti-Claudin 4 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88764-100
Supplier Catalog Number: A88764-100
Alternative Catalog Number: ABC-A88764-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CLDN4 (NP_001296.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Claudin 4.
Clonality: Polyclonal
Molecular Weight: 22 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: VGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Target: Claudin 4
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:100