Anti-BTF3 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A88770-50
Article Name: |
Anti-BTF3 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A88770-50 |
Supplier Catalog Number: |
A88770-50 |
Alternative Catalog Number: |
ABC-A88770-50 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BTF3 (NP_001198.2). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to BTF3. |
Clonality: |
Polyclonal |
Molecular Weight: |
18 kDa / 22 kDa |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Form: |
Liquid |
Sequence: |
KLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLV |
Target: |
BTF3 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
WB: 1:500-1:1,000 |