Anti-Oligodendrocyte Specific Protein Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88810-50
Article Name: Anti-Oligodendrocyte Specific Protein Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88810-50
Supplier Catalog Number: A88810-50
Alternative Catalog Number: ABC-A88810-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN11 (NP_005593.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Oligodendrocyte Specific Protein.
Clonality: Polyclonal
Molecular Weight: 22 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLL
Target: Oligodendrocyte Specific Protein
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:100