Anti-glutathione S transferase Omega 1 / p28 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89004-50
Article Name: Anti-glutathione S transferase Omega 1 / p28 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89004-50
Supplier Catalog Number: A89004-50
Alternative Catalog Number: ABC-A89004-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human GSTO1 (NP_004823.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to glutathione S transferase Omega 1 / p28.
Clonality: Polyclonal
Molecular Weight: 27 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Target: glutathione S transferase Omega 1 / p28
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000