Anti-HSCB Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89015-50
Article Name: Anti-HSCB Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89015-50
Supplier Catalog Number: A89015-50
Alternative Catalog Number: ABC-A89015-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human HSCB (NP_741999.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to HSCB.
Clonality: Polyclonal
Molecular Weight: 27 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: AASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
Target: HSCB
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000