Anti-MYF6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89019-100
Article Name: Anti-MYF6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89019-100
Supplier Catalog Number: A89019-100
Alternative Catalog Number: ABC-A89019-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MYF6.
Clonality: Polyclonal
Molecular Weight: 27 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
Target: MYF6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000