Anti-NOTCH3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89029-50
Article Name: Anti-NOTCH3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89029-50
Supplier Catalog Number: A89029-50
Alternative Catalog Number: ABC-A89029-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2200 to the C-terminus of human NOTCH3 (NP_000426.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NOTCH3.
Clonality: Polyclonal
Molecular Weight: 90 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: TPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Target: NOTCH3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:5,000, IHC: 1:50-1:200