Anti-Trichohyalin Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89030-50
Article Name: Anti-Trichohyalin Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89030-50
Supplier Catalog Number: A89030-50
Alternative Catalog Number: ABC-A89030-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human TCHH (NP_009044.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Trichohyalin.
Clonality: Polyclonal
Molecular Weight: 280 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: RARCDGKESLLQDRRQEEDQRRFEPRDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERLEQRDRQRRDEELWRQRQEWQEREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRRERQEEEQQQQRL
Target: Trichohyalin
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000