Anti-KAT3B / p300 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89032-100
Article Name: Anti-KAT3B / p300 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89032-100
Supplier Catalog Number: A89032-100
Alternative Catalog Number: ABC-A89032-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EP300 (NP_001420.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to KAT3B / p300.
Clonality: Polyclonal
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYG
Target: KAT3B / p300
Antibody Type: Primary Antibody
Application Dilute: IHC: 1:50-1:200, ICC/IF: 1:50-1:200