Anti-LYPLAL1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89040-50
Article Name: Anti-LYPLAL1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89040-50
Supplier Catalog Number: A89040-50
Alternative Catalog Number: ABC-A89040-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYPLAL1 (NP_620149.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to LYPLAL1.
Clonality: Polyclonal
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQV
Target: LYPLAL1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000