Anti-Aquaporin 1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89041-50
Article Name: Anti-Aquaporin 1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89041-50
Supplier Catalog Number: A89041-50
Alternative Catalog Number: ABC-A89041-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Aquaporin-1 (Aquaporin-1 (AQP1)) (NP_932766.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Aquaporin 1.
Clonality: Polyclonal
Molecular Weight: 25 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Target: Aquaporin 1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200