Anti-XRCC6BP1 / KUB3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89059-50
Article Name: Anti-XRCC6BP1 / KUB3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89059-50
Supplier Catalog Number: A89059-50
Alternative Catalog Number: ABC-A89059-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human ATP23 (NP_150592.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to XRCC6BP1 / KUB3.
Clonality: Polyclonal
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
Target: XRCC6BP1 / KUB3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:3,000