Anti-Myf5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89065-100
Article Name: Anti-Myf5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89065-100
Supplier Catalog Number: A89065-100
Alternative Catalog Number: ABC-A89065-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 143-220 of human MYF5 (NP_005584.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Myf5.
Clonality: Polyclonal
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQP
Target: Myf5
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000