Anti-MLF2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89074-50
Article Name: Anti-MLF2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89074-50
Supplier Catalog Number: A89074-50
Alternative Catalog Number: ABC-A89074-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MLF2.
Clonality: Polyclonal
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS
Target: MLF2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:100-1:200