Anti-IGFBP4 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89075-100
Article Name: Anti-IGFBP4 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89075-100
Supplier Catalog Number: A89075-100
Alternative Catalog Number: ABC-A89075-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 178-258 of human IGFBP4 (NP_001543.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to IGFBP4.
Clonality: Polyclonal
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Target: IGFBP4
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000