Anti-AKR1C1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89628-100
Article Name: Anti-AKR1C1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89628-100
Supplier Catalog Number: A89628-100
Alternative Catalog Number: ABC-A89628-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C1 (NP_001344.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to AKR1C1.
Clonality: Polyclonal
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL
Target: AKR1C1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:3,000