Anti-CSNK2A2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89640-100
Article Name: Anti-CSNK2A2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89640-100
Supplier Catalog Number: A89640-100
Alternative Catalog Number: ABC-A89640-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CSNK2A2 (NP_001887.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CSNK2A2.
Clonality: Polyclonal
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEE
Target: CSNK2A2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:100, ICC/IF: 1:50-1:100