Anti-KCNK3 / TASK1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89655-100
Article Name: Anti-KCNK3 / TASK1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89655-100
Supplier Catalog Number: A89655-100
Alternative Catalog Number: ABC-A89655-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-394 of human KCNK3 (NP_002237.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to KCNK3 / TASK1.
Clonality: Polyclonal
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: NAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Target: KCNK3 / TASK1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200