Anti-GPCR GPR6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89656-100
Article Name: Anti-GPCR GPR6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89656-100
Supplier Catalog Number: A89656-100
Alternative Catalog Number: ABC-A89656-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 253-362 of human GPR6 (NP_005275.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GPCR GPR6.
Clonality: Polyclonal
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: WRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
Target: GPCR GPR6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100