Anti-Caspase-12 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A89676-100
| Article Name: |
Anti-Caspase-12 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A89676-100 |
| Supplier Catalog Number: |
A89676-100 |
| Alternative Catalog Number: |
ABC-A89676-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Caspase-12. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
55 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS |
| Target: |
Caspase-12 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:1,000, IHC: 1:50-1:200 |
