Anti-HAP40 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89677-100
Article Name: Anti-HAP40 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89677-100
Supplier Catalog Number: A89677-100
Alternative Catalog Number: ABC-A89677-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human F8A1 (NP_036283.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to HAP40.
Clonality: Polyclonal
Molecular Weight: 39 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: AALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSG
Target: HAP40
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000