Anti-MATH2 / NEUROD6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89697-100
Article Name: Anti-MATH2 / NEUROD6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89697-100
Supplier Catalog Number: A89697-100
Alternative Catalog Number: ABC-A89697-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 188-337 of human NEUROD6 (NP_073565.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MATH2 / NEUROD6.
Clonality: Polyclonal
Molecular Weight: 39 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: FLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
Target: MATH2 / NEUROD6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000