Anti-Melatonin Receptor 1A / MTNR1A Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A89707-100
| Article Name: |
Anti-Melatonin Receptor 1A / MTNR1A Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A89707-100 |
| Supplier Catalog Number: |
A89707-100 |
| Alternative Catalog Number: |
ABC-A89707-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human MTNR1A (NP_005949.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Melatonin Receptor 1A / MTNR1A. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
39 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV |
| Target: |
Melatonin Receptor 1A / MTNR1A |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:1,000-1:5,000, IHC: 1:100-1:200 |
