Anti-CysLT2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89714-50
Article Name: Anti-CysLT2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89714-50
Supplier Catalog Number: A89714-50
Alternative Catalog Number: ABC-A89714-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human CYSLTR2 (NP_001295394.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CysLT2.
Clonality: Polyclonal
Molecular Weight: 40 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: TMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
Target: CysLT2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000