Anti-Ribonuclease 3 / ECP Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8972-50
Article Name: |
Anti-Ribonuclease 3 / ECP Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A8972-50 |
Supplier Catalog Number: |
A8972-50 |
Alternative Catalog Number: |
ABC-A8972-50 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 28-160 of human RNASE3 (NP_002926.2). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to Ribonuclease 3 / ECP. |
Clonality: |
Polyclonal |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
Form: |
Liquid |
Sequence: |
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI |
Target: |
Ribonuclease 3 / ECP |
Antibody Type: |
Primary Antibody |
Application Dilute: |
IHC: 1:50-1:100 |