Anti-Ribonuclease 3 / ECP Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8972-50
| Article Name: |
Anti-Ribonuclease 3 / ECP Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A8972-50 |
| Supplier Catalog Number: |
A8972-50 |
| Alternative Catalog Number: |
ABC-A8972-50 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 28-160 of human RNASE3 (NP_002926.2). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Ribonuclease 3 / ECP. |
| Clonality: |
Polyclonal |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI |
| Target: |
Ribonuclease 3 / ECP |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
IHC: 1:50-1:100 |
