Anti-TLX1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89725-100
Article Name: Anti-TLX1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89725-100
Supplier Catalog Number: A89725-100
Alternative Catalog Number: ABC-A89725-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TLX1.
Clonality: Polyclonal
Molecular Weight: 40 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTG
Target: TLX1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:2,000