Anti-WSB2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89726-50
Article Name: Anti-WSB2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89726-50
Supplier Catalog Number: A89726-50
Alternative Catalog Number: ABC-A89726-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human WSB2 (NP_061109.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to WSB2.
Clonality: Polyclonal
Molecular Weight: 40 - 43 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWV
Target: WSB2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200