Anti-Tristetraprolin / TTP Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8974-100
| Article Name: |
Anti-Tristetraprolin / TTP Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A8974-100 |
| Supplier Catalog Number: |
A8974-100 |
| Alternative Catalog Number: |
ABC-A8974-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 230-326 of human ZFP36 (NP_003398.3). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Tristetraprolin / TTP. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
29 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
SAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE |
| Target: |
Tristetraprolin / TTP |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:1,000 |
