Anti-SDF4 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89752-100
Article Name: Anti-SDF4 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89752-100
Supplier Catalog Number: A89752-100
Alternative Catalog Number: ABC-A89752-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 37-200 of human SDF4 (NP_057260.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SDF4.
Clonality: Polyclonal
Molecular Weight: 40 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: RPANHSSTRERVANREENEILPPDHLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEETQEVLENL
Target: SDF4
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000, IHC: 1:50-1:200