Anti-GPR62 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89759-50
Article Name: Anti-GPR62 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89759-50
Supplier Catalog Number: A89759-50
Alternative Catalog Number: ABC-A89759-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GPR62.
Clonality: Polyclonal
Molecular Weight: 39 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF
Target: GPR62
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000