Anti-GPCR GPR87 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89760-50
Article Name: Anti-GPCR GPR87 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89760-50
Supplier Catalog Number: A89760-50
Alternative Catalog Number: ABC-A89760-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR87 (NP_076404.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to GPCR GPR87.
Clonality: Polyclonal
Molecular Weight: 41 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: HNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITLFLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVR
Target: GPCR GPR87
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000