Anti-CCL21 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8977-100
| Article Name: |
Anti-CCL21 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A8977-100 |
| Supplier Catalog Number: |
A8977-100 |
| Alternative Catalog Number: |
ABC-A8977-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-134 of human CCL21 (NP_002980.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to CCL21. |
| Clonality: |
Polyclonal |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Target: |
CCL21 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
IHC: 1:50-1:100 |
