Anti-CCL21 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8977-50
Article Name: |
Anti-CCL21 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A8977-50 |
Supplier Catalog Number: |
A8977-50 |
Alternative Catalog Number: |
ABC-A8977-50 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-134 of human CCL21 (NP_002980.1). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to CCL21. |
Clonality: |
Polyclonal |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
Form: |
Liquid |
Sequence: |
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Target: |
CCL21 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
IHC: 1:50-1:100 |