Anti-LARP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89852-50
Article Name: Anti-LARP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89852-50
Supplier Catalog Number: A89852-50
Alternative Catalog Number: ABC-A89852-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human Septin 1 (NP_443070.5).
Conjugation: Unconjugated
Rabbit polyclonal antibody to LARP.
Clonality: Polyclonal
Molecular Weight: 48 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: IPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPM
Target: LARP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:100, ICC/IF: 1:50-1:100