Anti-SLC14A1 / UTE Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89857-100
Article Name: Anti-SLC14A1 / UTE Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89857-100
Supplier Catalog Number: A89857-100
Alternative Catalog Number: ABC-A89857-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human SLC14A1 (NP_001295208.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SLC14A1 / UTE.
Clonality: Polyclonal
Molecular Weight: 35 - 45 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: QIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL
Target: SLC14A1 / UTE
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200