Anti-TAZ Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89897-100
Article Name: Anti-TAZ Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89897-100
Supplier Catalog Number: A89897-100
Alternative Catalog Number: ABC-A89897-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TAZ (NP_056287.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TAZ.
Clonality: Polyclonal
Molecular Weight: 55 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Target: TAZ
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200