Anti-CDC2L6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90570-50
Article Name: Anti-CDC2L6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90570-50
Supplier Catalog Number: A90570-50
Alternative Catalog Number: ABC-A90570-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP_005266928.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CDC2L6.
Clonality: Polyclonal
Molecular Weight: 57 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS
Target: CDC2L6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200