Anti-Nac1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90585-100
Article Name: Anti-Nac1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90585-100
Supplier Catalog Number: A90585-100
Alternative Catalog Number: ABC-A90585-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Nac1.
Clonality: Polyclonal
Molecular Weight: 57 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: QQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL
Target: Nac1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:100-1:200