Anti-CREB5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90589-50
Article Name: Anti-CREB5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90589-50
Supplier Catalog Number: A90589-50
Alternative Catalog Number: ABC-A90589-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-330 of human CREB5 (NP_878902.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CREB5.
Clonality: Polyclonal
Molecular Weight: 57 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: HPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTG
Target: CREB5
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:5,000