Anti-TRIM38 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9059-50
Article Name: Anti-TRIM38 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9059-50
Supplier Catalog Number: A9059-50
Alternative Catalog Number: ABC-A9059-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 266-465 of human TRIM38 (NP_006346.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TRIM38.
Clonality: Polyclonal
Molecular Weight: 53 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: VSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEAGVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD
Target: TRIM38
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000