Anti-OXSR1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90598-100
Article Name: Anti-OXSR1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90598-100
Supplier Catalog Number: A90598-100
Alternative Catalog Number: ABC-A90598-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OXSR1 (NP_005100.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to OXSR1.
Clonality: Polyclonal
Molecular Weight: 60 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV
Target: OXSR1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200