Anti-K80 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9668-100
Article Name: Anti-K80 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9668-100
Supplier Catalog Number: A9668-100
Alternative Catalog Number: ABC-A9668-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 242-452 of human KRT80 (NP_872313.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to K80.
Clonality: Polyclonal
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: SRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE
Target: K80
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:200