Anti-K80 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A9668-100
Article Name: |
Anti-K80 Antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
ABC-A9668-100 |
Supplier Catalog Number: |
A9668-100 |
Alternative Catalog Number: |
ABC-A9668-100 |
Manufacturer: |
Antibodies.com |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ICC |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 242-452 of human KRT80 (NP_872313.2). |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to K80. |
Clonality: |
Polyclonal |
Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
Form: |
Liquid |
Sequence: |
SRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE |
Target: |
K80 |
Antibody Type: |
Primary Antibody |
Application Dilute: |
ICC/IF: 1:50-1:200 |