Anti-KTN1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9762-50
Article Name: Anti-KTN1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9762-50
Supplier Catalog Number: A9762-50
Alternative Catalog Number: ABC-A9762-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to KTN1.
Clonality: Polyclonal
Molecular Weight: 166kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Sequence: MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
Target: KTN1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2000, IHC: 1:50-1:200