Anti-SLM-1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9793-100
Article Name: Anti-SLM-1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9793-100
Supplier Catalog Number: A9793-100
Alternative Catalog Number: ABC-A9793-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SLM-1.
Clonality: Polyclonal
Molecular Weight: 39 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: TAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
Target: SLM-1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:100-1:200