Anti-DcR2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9798-50
Article Name: Anti-DcR2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9798-50
Supplier Catalog Number: A9798-50
Alternative Catalog Number: ABC-A9798-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 257-386 of human TNFRSF10D (NP_003831.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to DcR2.
Clonality: Polyclonal
Molecular Weight: 47 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: VLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
Target: DcR2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200