Anti-ADFP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9828-50
Article Name: Anti-ADFP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9828-50
Supplier Catalog Number: A9828-50
Alternative Catalog Number: ABC-A9828-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 338-437 of human Perilipin-2 (NP_001113.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ADFP.
Clonality: Polyclonal
Molecular Weight: 48 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: NIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH
Target: ADFP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200