Anti-SIVA Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9834-100
Article Name: Anti-SIVA Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9834-100
Supplier Catalog Number: A9834-100
Alternative Catalog Number: ABC-A9834-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SIVA1 (NP_068355.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SIVA.
Clonality: Polyclonal
Molecular Weight: 15 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Target: SIVA
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000