Anti-Arg2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9841-50
Article Name: Anti-Arg2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9841-50
Supplier Catalog Number: A9841-50
Alternative Catalog Number: ABC-A9841-50
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-354 of human Arginase 2 (ARG2) (NP_001163.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Arg2.
Clonality: Polyclonal
Molecular Weight: 39 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: GLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
Target: Arg2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000